PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G0318
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 250aa    MW: 29352.8 Da    PI: 6.5226
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G0318genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEd++l+++v+ +G g+W+t++++ g+ R +k+c++rw +yl
      Gh_A07G0318 13 RGLWKPEEDLILKNYVETYGEGNWATVSKRSGLMRGGKSCRLRWKNYL 60
                     788*******************************************97 PP

2Myb_DNA-binding52.51.2e-1666111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A07G0318  66 RGGMSKEEEDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 111
                      67789*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.911160IPR017930Myb domain
SMARTSM007178.1E-131262IPR001005SANT/Myb domain
SuperFamilySSF466898.07E-2812107IPR009057Homeodomain-like
PfamPF002494.3E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-211467IPR009057Homeodomain-like
CDDcd001673.68E-101660No hitNo description
PROSITE profilePS5129425.60661115IPR017930Myb domain
SMARTSM007171.8E-1665113IPR001005SANT/Myb domain
PfamPF002495.4E-1566111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2368114IPR009057Homeodomain-like
CDDcd001674.58E-1269111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MENRKEKKSQ PKRGLWKPEE DLILKNYVET YGEGNWATVS KRSGLMRGGK SCRLRWKNYL  60
RPNIKRGGMS KEEEDLIIRM HKLLGNRWSL IAGRLPGRTD NEVKNYWNTH LNKKSLLGRK  120
RKTLDSNNQH NDNMEDNHIE NQDSKKPRQS HDSDHHPIFN TTDGFDLDGN KQEKDDESAA  180
AWMERTVQFF NYEYDLDYEM VGTPLMMHPD YSNFVFDEEP FTSYMDPFVL FEAFGTADYD  240
VGLGIQSFLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-24131147107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6238505e-66JX623850.1 Gossypium hirsutum clone NBRI_GE71318 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446931.10.0PREDICTED: transcription factor MYB82-like
SwissprotQ9LTF76e-69MYB82_ARATH; Transcription factor MYB82
TrEMBLA0A0D2N5C00.0A0A0D2N5C0_G
STRINGPOPTR_0018s12780.15e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-70myb domain protein 82